A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10448 |
Swiss-prot Accession number | P22077 (Sequence in FASTA format) |
Description | Somatotropin precursor (Growth hormone). |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | Pituitary gland |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control |
Protein Length | 216 Amino acids |
Molecular weight | 24747 |
References | 1 PubMed abstract 2125220 2 PubMed abstract 2018514 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin |
Mature Hormone Sequence | TFPTMPLSNLFTNAVLRAQHLHLLAAETYKEFERTYIPEDQRYTNKNSQAAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPMQYLSKVFTNNLVFGTSDRVFEKLKDLEEGIQALMRELEDRSPRGPQLLRPTYDRFDIHLRSEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCNI |
Position of mature hormone in Pre-Hormone protein | 191 Residues from position (26-216) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10641 |
Swiss-prot Accession number | P45646 (Sequence in FASTA format) |
Description | Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain). |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids |
Protein Length | 159 Amino acids |
Molecular weight | 16285 |
References | 1 PubMed abstract 7772235 |
Domain Name | Cys_knot |
Hormone Name | Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta) |
Mature Hormone Sequence | LGGGGRPPCRPINVTVAVEKDECPQCMAVTTTACGGYCRTREPVYRSPLGRPPQSSCTYGALRYERWALWGCPIGSDPRVLLPVALSCRCARCPIATSDCTVQGLGPAFCGAPGGFGIGE |
Position of mature hormone in Pre-Hormone protein | 120 Residues from position (40-159) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10685 |
Swiss-prot Accession number | P68249 (Sequence in FASTA format) |
Description | Pancreatic hormone (Pancreatic polypeptide) (PP). |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the NPY family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions |
Protein Length | 36 Amino acids |
Molecular weight | 4239 |
References | 1 PubMed abstract 913391 2 PubMed abstract 16593056 3 PubMed abstract 6673760 |
Domain Name | Hormone_3 |
Hormone Name | Pancreatic hormone |
Mature Hormone Sequence | GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY |
Position of mature hormone in Pre-Hormone protein | 36 Residues from position (1-36) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | 1PPT 2BF9 |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10857 |
Swiss-prot Accession number | P67968 (Sequence in FASTA format) |
Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 51 Amino acids |
Molecular weight | 5698 |
References | 1 PubMed abstract 5066110 |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | AANQHLCGSHLVEALYLVCGERGFFYSPKA |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (1-30) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10858 |
Swiss-prot Accession number | P67968 (Sequence in FASTA format) |
Description | Insulin [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 51 Amino acids |
Molecular weight | 5698 |
References | 1 PubMed abstract 5066110 |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | GIVEQCCHNTCSLYQLENYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (31-51) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10992 |
Swiss-prot Accession number | P68241 (Sequence in FASTA format) |
Description | Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha). |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 120 Amino acids |
Molecular weight | 13591 |
References | 1 PubMed abstract 1723796 2 PubMed abstract 1701134 3 PubMed abstract 1723796 4 PubMed abstract 1701134 |
Domain Name | Hormone_6 |
Hormone Name | Glycoprotein hormones alpha chain |
Mature Hormone Sequence | FPDGEFLMQGCPECKLGENRFFSKPGAPIYQCTGCCFSRAYPTPMRSKKTMLVPKNITSEATCCVAKAFTKITLKDNVKIENHTDCHCSTCYYHKS |
Position of mature hormone in Pre-Hormone protein | 96 Residues from position (25-120) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11102 |
Swiss-prot Accession number | P68260 (Sequence in FASTA format) |
Description | Glucagon. |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted (By similarity) |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis |
Protein Length | 29 Amino acids |
Molecular weight | 3456 |
References | 1 PubMed abstract 4645932 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon |
Mature Hormone Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMST |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (1-29) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11413 |
Swiss-prot Accession number | P17572 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Meleagris gallopavo (Common turkey) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | Three forms are found, non-glycosylated, glycosylated and one form seems to be only O-glycosylated. |
Function | N/A |
Protein Length | 229 Amino acids |
Molecular weight | 25854 |
References | 1 PubMed abstract 8618952 2 PubMed abstract 1879669 3 PubMed abstract 2349117 4 PubMed abstract 1769204 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | LPICSSGSVNCQVSLGELFDRAVRLSHYIHFLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQTQQIHHEELLNLILGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRIHSGDAGNEVFSQWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDNNC |
Position of mature hormone in Pre-Hormone protein | 199 Residues from position (31-229) |
Receptor | Q91094
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |